Automatic Face Detection in Photos with PHP

I have always wondered how to detect faces automatically with php script. I have seen in many photo sharing and social network sites automatically detect a face and tag a name after being uploaded.

In this article, i will explain how possible this task can be achieved with simplicity with OpenCV and PHP Facedetect extension. Both are free to download and opensource.


To auto detect faces in a photo and draw pink box around the faces with a php script running a linux centos server. Please note that face detection and face recognition are two different things. To recognize a face you have to first detect a face and then do the required processing.


– Linux server running Centos with SSH access
– PHP/Apache
– GD Library
– OpenCV [Download]
– PHP Facedetect extension [Download]

PHP facedetect extension is very simple. All you have to do is call a function face_detect(p) and it will give all the x,y coordinates in a photo where we draw a square. face_count() will output how many total faces in the given photo. For documentation see here


We install opencv and then we compile the php facedetect extension with php.

How to Install OpenCV

If you are running centos then one single line will install opencv.

yum install opencv

OpenCV may also need the following depencies to work properly and you will need to install them as well.

yum install ibpng libpng-dev zlib libjpeg libjpeg-dev libtiff libjasper swig python pkgconfig gtk gtk-dev

For more installation instructions on linux see here

The opencv will be installed in/usr/local/share/opencv and all the important facedetection training files known as “haar training” can be found in haarcascades folder in xml format (like haarcascade_frontalface_alt.xml)

How to test run OpenCV

Inorder to test run opencv you have to compile the samples folder. Go to /usr/local/share/opencv/samples/c/

Run this command to compile to binary.


If you find large number of errors and variables not declared like shown below..

Package opencv was not found in the pkg-config search path.
Perhaps you should add the directory containing `opencv.pc’
to the PKG_CONFIG_PATH environment variable
No package ‘opencv’ found


export PKG_CONFIG_PATH=/usr/local/lib/pkgconfig

and then it will compile.

To test run the opencv run the following command in the c folder for a test.jpg photo.

./facedetect –cascade=”../haarcascades/haarcascade_frontalface_alt.xml” test.jpg

Since your server does not have Xwindow installed, you probably do not see the output just the processing time.

If you see error “error while loading shared libraries: cannot open shared object file: No such file or directory” then see this solution

Install PHP Facedetect Extension

Installing the PHP facedetect extension is very easy. Just download the package and compile it for PHP.

wget [download_file_path]
tar zxf facedetect-1.0.0


phpize && configure && make && make install

If you see phpize command not found error, install php developer libraries

yum install php-devel
yum install php5-devel


open php.ini and make sure you add this line.

If facedetect has been successful, you will see this enabled in test.php.


Thats it! all the installation part is over!

Writing a PHP Script

Before you start writing php script make sure you copy all xml files in /usr/local/share/opencv/haarcascades folder to the web folder.

and this simple two lines to from php to call the function

//face_count() outputs total faces detected
// face_detect() outputs assoc array of x,y,width,height of each face recognized

$total= face_count('test.jpg','haarcascade_frontalface_alt.xml');
$coord= face_detect('test.jpg','haarcascade_frontalface_alt.xml');

Make sure the path of xml files are correct else you would see a blank face or bool(false) output. Once you get this co-ordinates all we have to do is use php gd library to draw square around the face with the above coordinates.

This script will do that and you have call the script with photo file like this http://domain/face.php?file=test.jpg and the test.jpg file should be in the same folder

//face.php -> detects faces and draws a pink square on faces

function LoadJpeg($imgname)
    $im = @imagecreatefromjpeg($imgname); /* Attempt to open */
    if (!$im) { /* See if it failed */
        $im  = imagecreate(150, 30); /* Create a blank image */
        $bgc = imagecolorallocate($im, 255, 255, 255);
        $tc  = imagecolorallocate($im, 0, 0, 0);
        imagefilledrectangle($im, 0, 0, 150, 30, $bgc);
        /* Output an errmsg */
        imagestring($im, 1, 5, 5, "Error loading $imgname", $tc);
    return $im;

$total= face_count($_GET['file'],'haarcascade_frontalface_alt.xml');
$ord= face_detect($_GET['file'],'haarcascade_frontalface_alt.xml');

$im = LoadJpeg($_GET['file']);
$pink = imagecolorallocate($im, 255, 105, 180);

if(count($ord) > 0) {

foreach ($ord as $arr) {
imagerectangle($im,$arr['x'] ,$arr['y'] , $arr['x']+$arr['w'],
$arr['y']+$arr['h'], $pink);

header('Content-Type: image/jpeg');

Just remember haarcascade_frontalface_alt.xml are haar training files used for face detection. You can play around with other training files like to detect various body parts, not just faces.


Conclusion and the Results


(standard test image used for image processing)

I have given multiple frontal detection photos to the script and the script performed well, despite few false face detections. One sample output file is shown below with the pink boxes detected by the script as faces. Unfortunately i can only show the blurred faces because of personal reasons.


I should say i am pretty surprised the way the multiple faces are detected and the results are good with haarcascade_frontalface_alt.xml as training file . To get more accurate results, you need to do haar training to xml files to produce more accurate results.

Other Useful Links

Facedetection with pure PHP without OpenCV [visit site]
Facedetection with javascript [visit site]
OpenCV Face Detection Page [visit site]


Similar Posts:


Balakrishnan Prabhu

Mr. Balakrishnan Prabhu is the founder of Corpocrat magazine. He is also the founder of Best Citizenships (BC), assisting wealthy individuals with with global citizenship and residency programs in Europe. His other interests are Linux, Machine learning, Wordpress, etc. You can contact him here

  • Windows

    If this would work under windows it would be perfect as I don’t have any native linux machine here around. But on the other side, my gpu is not working with linux (amd) even with official drivers (for the gpu support of opencv).

    But compiling this for windows is taking to much time and I didn’t proceed there.

  • allenn

    Many thanks!! Simple and understandable… I install this on my ubuntu server 14.02 and works fine.

  • Ricky Ponting

    Hello Prabhu Sir,

    I have try to implement this script in my local pc

    $coord= face_detect(‘shree.jpg’,’haarcascade_eye.xml’);

    then i have get Output : boolean false

    haarcascade_eye.xml file present in root folder i.e path of xml file right

    please reply as soon as possible

    Thanks ,

    • Prabhu Balakrishnan

      Hey Ricky, It looks to me haarcascade_frontalface_alt.xml is missing. Search this file using locate command and write its path.

      • Ricky Ponting

        Hi Sir,

        haarcascade_frontalface_alt.xml file path is right.

        Following is my file structure

        1) D:wampwwwmyfacedetectface.php

        face.php is file which having code like

        $total= face_count(‘shree.jpg’,’haarcascade_frontalface_alt.xml’);

        $coord= face_detect(‘shree.jpg’,’haarcascade_frontalface_alt.xml’);


        2) D:wampwwwmyfacedetecthaarcascade_frontalface_alt.xml . XML file also present on same directory name is “facedetect”.

        Note: php script file and XML file both are same facedetect folder

        When I have checked php error log file then found error like

        PHP Warning: PHP Startup: Unable to load dynamic library ‘D:/wamp/bin/php/php5.5.12/ext/php_intl.dll’ – The specified module could not be found.

        please reply me as soon as possible

        • Prabhu Balakrishnan

          what is the output of var_dump? PHP throws warning which you can ignore.

          • Ricky Ponting

            var_dump($coord); print output like boolean false.

          • Prabhu Balakrishnan

            It should give you different x,y coordinates in an array. Fix the apache php_intl.dll. Are you sure opencv is installed properly? you must have this library also installed:

          • Ricky Ponting

            Hi Sir,

            I have fix apache php_intl.dll problem & Already OpenCv ,facedetect library is also installed.Please check attched phpinfo image.

            Waiting for your Advise

    • Prabhu Balakrishnan

      I am pretty sure, that haarcascade xml file is missing. It causes blank NULL error. The path for xml file is this

      /usr/share/opencv/haarcascades not in the php folder. I dont know about windows.

  • Lokendra Saini

    Good job!!! very important information…

  • Shiva Kumar


  • Jade Gardner

    This is an amazing useful query. Thanks for sharing.